PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 27529.m000047
Common NameLOC8273265, RCOM_0031770
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRAS
Protein Properties Length: 542aa    MW: 61122.8 Da    PI: 6.0347
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
27529.m000047genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS412.93e-1261735422374
           GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                    ++ L++cA+a+s+gd ++a al+  l++++s +g+p+qRl ay++e+L+ar+  s+s++y+al++++     ss+ ++++ ++++++P+ +f++  
  27529.m000047 173 RQILFACAQAISDGDISRAAALMHVLEQMVSVSGEPIQRLGAYMLEGLRARVELSGSKIYRALKCEAPV---SSDLMTYMGILFKICPYWRFAYTS 265
                    689****************************************************************98...99999999**************** PP

           GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledlel 191
                    aN  I eave e r+HiiDf+i qG+QW+ L+qaLa+Rp+gpp +RiTgv++p+s   +   l  +g+rL++fAe+ +vpf+f+  +a +  +++l
  27529.m000047 266 ANVIIREAVEYEPRIHIIDFQIAQGTQWIYLMQALADRPGGPPAIRITGVDDPQSAyaRGGGLDIVGKRLSSFAESHNVPFQFHD-AAMSGCEVQL 360
                    ******************************************************9999999************************.89999***** PP

           GRAS 192 eeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEr 287
                    e+L v+pgEa++Vn+ + lh+++desvs+ ++rd++L+lvkslsPkvv+++eqe+++n+++Fl rf e+leyy a+f+s++a+ +r++++ri+ E+
  27529.m000047 361 EHLCVRPGEAVVVNFPYVLHHMPDESVSTWNHRDRLLRLVKSLSPKVVTLIEQESNTNTKPFLPRFKETLEYYNAMFESIDAGSSRDDKQRINAEQ 456
                    ************************************************************************************************ PP

           GRAS 288 ellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                    ++++r+ivn++acega+r+erhe ++kWr+r+++aGF++ pls++++  ++ ll++++ + y ++e++g+l+l W++ ++ s SaWr
  27529.m000047 457 HCVARDIVNMIACEGADRVERHEVFGKWRSRFMMAGFTQHPLSSQVTIAVRDLLKEYDRR-YGLQEKDGALYLWWMNTAMSSSSAWR 542
                    **********************************************************66.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.211146523IPR005202Transcription factor GRAS
PfamPF035141.0E-123173542IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
Sequence ? help Back to Top
Protein Sequence    Length: 542 aa     Download sequence    Send to blast
MQTSQKHRNP AGIHGFYNHP QEIDQYGLSH IQILENSAFS DVGSQGTSVS FQTYKEEYFT  60
LESSSANAGF VGYDSPAASV SSNRSPFSPQ GSNSCLSDPH RSPDNTYGSP MSGVSSADDE  120
NALMRQKLRE LEFLLLGSES DITNCDFCFH HADQQARWDW TRMEEMIPRL DTRQILFACA  180
QAISDGDISR AAALMHVLEQ MVSVSGEPIQ RLGAYMLEGL RARVELSGSK IYRALKCEAP  240
VSSDLMTYMG ILFKICPYWR FAYTSANVII REAVEYEPRI HIIDFQIAQG TQWIYLMQAL  300
ADRPGGPPAI RITGVDDPQS AYARGGGLDI VGKRLSSFAE SHNVPFQFHD AAMSGCEVQL  360
EHLCVRPGEA VVVNFPYVLH HMPDESVSTW NHRDRLLRLV KSLSPKVVTL IEQESNTNTK  420
PFLPRFKETL EYYNAMFESI DAGSSRDDKQ RINAEQHCVA RDIVNMIACE GADRVERHEV  480
FGKWRSRFMM AGFTQHPLSS QVTIAVRDLL KEYDRRYGLQ EKDGALYLWW MNTAMSSSSA  540
WR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-541745426375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015583874.10.0PREDICTED: scarecrow-like protein 13
RefseqXP_015583873.10.0PREDICTED: scarecrow-like protein 13
RefseqXP_015583872.10.0PREDICTED: scarecrow-like protein 13
RefseqXP_002534218.10.0PREDICTED: scarecrow-like protein 13
SwissprotQ9M0M50.0SCL13_ARATH; Scarecrow-like protein 13
TrEMBLB9T7J90.0B9T7J9_RICCO; Chitin-inducible gibberellin-responsive protein, putative
STRINGPOPTR_0016s01110.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43773360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17230.10.0SCARECROW-like 13